boltz

name	boltz
description	Run Boltz-1 / Boltz-2, MIT-licensed open foundation models for biomolecular structure and binding-affinity prediction. Use this skill when: (1) Predicting structures of protein monomers, multimers, and protein-protein complexes, (2) Predicting protein-ligand complexes (ligands as SMILES or CCD codes), (3) Predicting protein-DNA, protein-RNA, or mixed nucleic-acid complexes, (4) Predicting binding affinity (probability of binding and log10(IC50)) between a small molecule and a protein target — Boltz-2 only, (5) Validating designed binders / antibodies against a target (alternative to AlphaFold2 / Chai-1 with comparable or better accuracy on complexes, and 1000x faster than physics-based FEP for affinity), (6) Folding with pocket / contact / covalent-bond / template restraints, (7) Modeling cyclic peptides, modified residues (CCD), and non-canonical covalent bonds, (8) Running batched inference across one or many GPUs from a directory of YAML inputs. Covers installation (pip, GitHub, Docker), the `boltz predict` CLI and every flag, the YAML input schema (sequences / constraints / templates / properties), the deprecated FASTA format, MSA provisioning (ColabFold MMseqs2 server, custom `.a3m`, paired CSV, `empty` single-sequence mode, authenticated servers), the output layout (CIF/PDB structures, confidence JSON, affinity JSON, PAE / PDE / pLDDT NPZ files), Boltz-1 vs Boltz-2 feature parity, and the cache layout (`~/.boltz` or `$BOLTZ_CACHE`). Pairs with: `chai-lab` and `alphafold` (alternative structure predictors), `ipsae` (better ranking for binder design than ipTM), `protein-qc` (QC thresholds for designed binders), `binder-design` (tool selection for design campaigns), `bindcraft` / `rfdiffusion` / `boltzgen` / `genie3` (binder backbone generators whose outputs you validate with Boltz).
license	MIT
category	structure-prediction
tags	["structure-prediction","protein-complex","protein-ligand","affinity","msa","restraints","antibody","binder-validation","cyclic-peptide","foundation-model"]
repo	https://github.com/jwohlwend/boltz
preprint_boltz1	https://doi.org/10.1101/2024.11.19.624167
preprint_boltz2	https://doi.org/10.1101/2025.06.14.659707
slack	https://boltz.bio/join-slack

Boltz-1 / Boltz-2 — Open Biomolecular Structure & Affinity Prediction

What this is

Boltz is a family of MIT-licensed (code + weights) biomolecular foundation models from the Barzilay / Jaakkola groups at MIT:

Model	Released	Highlights
Boltz-1	Nov 2024	First fully open model to approach AlphaFold-3 accuracy on the PDB benchmark. Structure only.
Boltz-2	Jun 2025	New foundation model. Beats AF3 / Boltz-1 on structure and jointly predicts binding affinity (log10(IC50) + binder probability). Approaches FEP accuracy at ~1000x lower cost. Adds templates, multi-pocket constraints, contact constraints.

Boltz-2 is the default (--model boltz2); Boltz-1 is retained for parity with the original Boltz-1 paper (pass --model boltz1).

One model handles all of the following entities, declared in a YAML schema:

Entity	YAML keyword	What you provide
Protein	protein	1-letter sequence (+ optional msa, modifications, cyclic)
DNA	dna	ACGT sequence
RNA	rna	ACGU sequence
Ligand	ligand	SMILES string or 3-letter CCD code (exclusive)

Output: by default one mmCIF per diffusion sample ranked by an aggregate confidence score, plus a per-sample confidence JSON (pTM / ipTM / pLDDT breakdown, per-chain and per-chain-pair) and per-token PAE / PDE / pLDDT NPZ files. If properties.affinity is set, an affinity_*.json is also written.

Prerequisites

Requirement	Recommended	Notes
OS	Linux	macOS works on CPU only
Python	3.10 — 3.12	requires-python = ">=3.10,<3.13"
GPU	NVIDIA, CUDA 12.x, bfloat16	RTX 4090 / A10 / A30 fine for small complexes; A100 / H100 / L40S for big ones. cuEquivariance kernels accelerate recent NVIDIA cards. Old GPUs: pass --no_kernels.
Disk	~5 GB cache	Weights + CCD auto-download into ~/.boltz (or $BOLTZ_CACHE).
Network	Needed for first weight download, and for --use_msa_server (ColabFold MMseqs2)

Boltz can run on CPU (no [cuda] extras), but is significantly slower — treat that as a fallback for unit testing only. TPU is also accepted (--accelerator tpu) but seldom used.

Three-step quick start

1) Install

# Recommended (PyPI, with CUDA extras):
pip install -U "boltz[cuda]"

# Or development build:
git clone https://github.com/jwohlwend/boltz.git
cd boltz && pip install -e ".[cuda]"

# CPU-only (slow):
pip install -U boltz

A boltz console script is installed. On first run it auto-downloads:

• boltz2_conf.ckpt (structure model) and boltz2_aff.ckpt (affinity head)
• mols.tar → mols/ (per-residue / per-ligand reference structures for Boltz-2)
• ccd.pkl (Boltz-1 CCD dictionary, if you also use Boltz-1)

into ~/.boltz (override with --cache /path or env BOLTZ_CACHE=/abs/path).

2) Write a YAML and predict

# /tmp/example.yaml
version: 1
sequences:
  - protein:
      id: A
      sequence: MVTPEGNVSLVDESLLVGVTDEDRAVRSAHQFYERLIGLWAPAVMEAAHELG
  - ligand:
      id: B
      smiles: 'N[C@@H](Cc1ccc(O)cc1)C(=O)O'
properties:
  - affinity:
      binder: B          # Boltz-2 only

boltz predict /tmp/example.yaml --use_msa_server --out_dir /tmp/boltz_out

--use_msa_server is essentially mandatory for protein chains unless you supply a local .a3m (msa: path/to.a3m) or explicitly opt out (msa: empty, which is single-sequence mode and degrades accuracy).

3) Inspect outputs

/tmp/boltz_out/
└── boltz_results_example/
    ├── predictions/
    │   └── example/
    │       ├── example_model_0.cif                 # best (highest confidence_score)
    │       ├── confidence_example_model_0.json     # ptm, iptm, plddt, per-chain, per-pair
    │       ├── pae_example_model_0.npz             # if --write_full_pae
    │       ├── pde_example_model_0.npz             # if --write_full_pde
    │       ├── plddt_example_model_0.npz
    │       ├── affinity_example.json               # if properties.affinity was set
    │       └── ...                                 # one set per diffusion sample
    ├── processed/                                  # preprocessed inputs (caches between runs)
    └── lightning_logs/

The candidate with the highest confidence_score (≈ 0.8 * complex_plddt + 0.2 * iptm) is the recommended pick. See references/outputs.md for the full schema.

CLI at a glance

Command	Purpose
boltz predict INPUT [OPTIONS]	Predict structure (+ affinity) for one YAML, one FASTA, or a directory of either.

INPUT can be:

• a single .yaml / .fasta file, or
• a directory; every .yaml and .fasta inside is predicted.

The most important flags (full list in references/cli.md):

Flag	Meaning
--out_dir PATH	Where to save the predictions (default ./). A boltz_results_<input_stem>/ directory is created inside.
--cache PATH	Where to download / look up model weights and CCD (default ~/.boltz, or $BOLTZ_CACHE).
--use_msa_server	Auto-generate MSAs via ColabFold MMseqs2 (https://api.colabfold.com).
--msa_server_url URL	Self-hosted ColabFold endpoint.
--msa_pairing_strategy greedy|complete	MSA pairing for multimers (default greedy).
--use_potentials	Inference-time potentials for better physical plausibility (slower but cleaner poses).
--model boltz1|boltz2	Which checkpoint (default boltz2).
--method NAME	Condition the prediction on a structural-determination method (e.g. x-ray diffraction, electron microscopy, md, afdb, boltz-1). Boltz-2 only.
--recycling_steps N	Trunk recycles (default 3; AF3-style is 10).
--sampling_steps N	Diffusion sampling steps (default 200).
--diffusion_samples N	Number of candidate structures (default 1; AF3-style is 25).
--max_parallel_samples N	Parallel diffusion batch (default 5).
--step_scale FLOAT	Diffusion temperature; default 1.5 (Boltz-2) / 1.638 (Boltz-1). Lower → more diverse.
--output_format mmcif|pdb	Output format (default mmcif).
--devices N	GPUs to use; >1 enables DDP.
--accelerator gpu|cpu|tpu	Default gpu.
--seed N	RNG seed.
--override	Re-run instead of reusing cached processed/ and existing predictions.
--write_full_pae / --write_full_pde	Dump per-token PAE / PDE NPZ.
--write_embeddings	Dump s and z embeddings as NPZ.
--no_kernels	Disable cuEquivariance kernels (use this on old NVIDIA cards).
--num_workers N	DataLoader workers (default 2).
--preprocessing-threads N	Threads for preprocessing (default = cpu count).
--max_msa_seqs N	Cap MSA depth (default 8192).
--subsample_msa / --num_subsampled_msa N	Subsample MSA at runtime.

Affinity (Boltz-2 only — see references/affinity.md):

Flag	Meaning
--sampling_steps_affinity N	Default 200.
--diffusion_samples_affinity N	Default 5.
--affinity_mw_correction	Add the molecular-weight correction to the affinity head.
--affinity_checkpoint PATH	Custom affinity checkpoint.

MSA server auth — see references/msas.md.

Choosing the right reference doc

You want to…	Read
Install, manage downloads, use the Docker image, configure cache	references/installation.md
See every CLI flag with examples	references/cli.md
Author the YAML input (sequences, ligands, modifications, cyclic)	references/inputs.md
Add MSAs (ColabFold server, local .a3m, paired CSV, auth)	references/msas.md
Supply structural templates (CIF / PDB)	references/templates.md
Use pocket / contact / covalent-bond constraints	references/constraints.md
Predict binding affinity with Boltz-2	references/affinity.md
Read the CIF / JSON / NPZ outputs	references/outputs.md
Validate a designed binder / antibody	references/binder-validation.md
Run hundreds of YAMLs across GPUs	references/batch.md
Train / retrain on your own data	references/training.md
Diagnose OOM, kernel, MSA, weight-download failures	references/troubleshooting.md
Boltz-1 vs Boltz-2 feature matrix and migration notes	references/boltz1-vs-boltz2.md

Quick decision tree

• You just have sequences and want a structure → 1-chain YAML, boltz predict in.yaml --use_msa_server. Defaults are fine.
• You want AF3-level sampling (5 samples × 10 recycles) → --diffusion_samples 5 --recycling_steps 10. ~10x slower.
• You designed a binder and want to validate it → 2-chain YAML (binder + target), --use_msa_server. Score with ipTM and (better) ipSAE; see the ipsae and protein-qc skills.
• You want a binding-affinity number for a small molecule → Boltz-2 YAML with properties.affinity.binder: <ligand_id>. Output is affinity_pred_value (log10(IC50_µM), lower = stronger binder) and affinity_probability_binary (probability the ligand binds at all). See references/affinity.md.
• You know the binding pocket / specific contacts → add a pocket or contact constraint to your YAML; set force: true to enforce it via a potential.
• Cyclic peptide → cyclic: true on the protein entry.
• Modified residue with a CCD code → modifications: [{position: 5, ccd: MSE}] on the polymer.
• Glycoprotein or covalently-bound ligand → declare the ligand and the polymer separately, then add a bond constraint linking the relevant atoms.
• Many YAMLs, several GPUs → put them in a directory, boltz predict dir/ --devices 4. Predictions are sharded via DDP.
• You want the easiest UI → no official web server; use the CLI or the Slack community for help.

If Boltz is not the right tool, the alternatives are:

• Chai-1 (chai-lab skill) — similar foundation-model architecture, open weights, FASTA-like input, strong on glycans and explicit covalent bonds.
• AlphaFold 2 / 3 (alphafold skill) — AF2 is the long-standing baseline; AF3 is closed-source (web only).
• ESMFold — single-sequence, monomers only; fastest, lower accuracy on complexes.

Hard rules / gotchas

1. The output directory is reused across runs. Boltz keeps processed/ and skips inputs whose predictions already exist. Pass --override to redo from scratch when you change parameters but reuse the same --out_dir.
2. One affinity ligand per YAML. properties.affinity.binder must be a single ligand chain ID (not a list, not a polymer). Boltz-2 only.
3. Affinity ligand size caps. Hard limit: ≤ 128 heavy atoms (counted after RDKit RemoveHs). Training cap was 56: ligands larger than that produce a WARNING and unreliable values.
4. Affinity vs. protein only. Running affinity on an RNA/DNA/cofactor target will not crash but the output is unreliable — Boltz-2 was trained only on small-molecule × protein.
5. Pocket distance. max_distance in pocket / contact constraints accepts 4–20 Å (default 6 Å). For Boltz-1, only 6 Å is supported, and at most one pocket constraint per YAML; Boltz-2 lifts both limits.
6. Templates and contact constraints are Boltz-2 only — they raise on Boltz-1.
7. --use_msa_server and a local MSA can be mixed: chains with msa: path/to.a3m use the local file; chains without msa: go to the server. msa: empty forces single-sequence (not recommended).
8. Paired multimer MSAs require CSV (sequence,key) not .a3m, with matching keys across chains.
9. Names / chain IDs. Polymer and ligand ids must be unique. Use a list ([A, B]) for identical entities — Boltz handles symmetry / pairing automatically.
10. Atom-name precision matters for bonds. bond.atom1: [chain, residue_idx, ATOM_NAME] uses CCD-standard atom names (case-sensitive). Verify against the RCSB CCD entry for that residue.
11. 1-indexed residues. position, RES_IDX, and contact / bond / pocket residue indices all start at 1.
12. Step scale. Default differs between models (1.638 Boltz-1, 1.5 Boltz-2). Lower → more diverse samples; recommended range 1–2.
13. Old NVIDIA cards. If you see a cuequivariance import / runtime error, add --no_kernels — slight perf hit but it works.
14. FASTA input is deprecated. It cannot express modifications, covalent bonds, pocket conditioning, templates, or affinity. Always prefer YAML.

Installing this skill

# Symlink (recommended — picks up edits live)
mkdir -p ~/.claude/skills
ln -s "$(pwd)" ~/.claude/skills/boltz

# Or copy:
cp -R . ~/.claude/skills/boltz

After that, an agent can invoke it via Skill(skill="boltz").

Citation

@article{passaro2025boltz2,
  author  = {Passaro, Saro and Corso, Gabriele and Wohlwend, Jeremy and Reveiz, Mateo and Thaler, Stephan and Somnath, Vignesh Ram and Getz, Noah and Portnoi, Tally and Roy, Julien and Stark, Hannes and Kwabi-Addo, David and Beaini, Dominique and Jaakkola, Tommi and Barzilay, Regina},
  title   = {Boltz-2: Towards Accurate and Efficient Binding Affinity Prediction},
  year    = {2025},
  doi     = {10.1101/2025.06.14.659707},
  journal = {bioRxiv}
}

@article{wohlwend2024boltz1,
  author  = {Wohlwend, Jeremy and Corso, Gabriele and Passaro, Saro and Getz, Noah and Reveiz, Mateo and Leidal, Ken and Swiderski, Wojtek and Atkinson, Liam and Portnoi, Tally and Chinn, Itamar and Silterra, Jacob and Jaakkola, Tommi and Barzilay, Regina},
  title   = {Boltz-1: Democratizing Biomolecular Interaction Modeling},
  year    = {2024},
  doi     = {10.1101/2024.11.19.624167},
  journal = {bioRxiv}
}

@article{mirdita2022colabfold,
  title   = {ColabFold: making protein folding accessible to all},
  author  = {Mirdita, Milot and Sch{\"u}tze, Konstantin and Moriwaki, Yoshitaka and Heo, Lim and Ovchinnikov, Sergey and Steinegger, Martin},
  journal = {Nature methods},
  year    = {2022}
}