| name | mber |
| description | VHH nanobody design using mBER (Manifold Binder Engineering and Refinement). Use this skill when: (1) Designing VHH nanobody CDRs against a target protein, (2) Have an existing VHH scaffold and want to redesign CDR1/CDR2/CDR3, (3) Optimizing a known VHH binder, (4) Targeting specific hotspot residues on the antigen, (5) Multi-chain antigen targets (with chain offsets).
For de novo antibody/nanobody CDR design, use iggm. For general protein binder design, use boltzgen or bindcraft.
|
| license | MIT |
| category | design-tools |
| tags | ["antibody","nanobody","vhh","sequence-design","mask-based"] |
| source | https://github.com/hgbrian/biomodals |
mBER VHH Nanobody Design
mBER uses structure templates and sequence conditioning (via AlphaFold-Multimer)
to design VHH nanobody binders against a target protein.
Prerequisites
| Requirement | Minimum | Recommended |
|---|
| GPU VRAM | 40GB | 80GB (A100) |
How to run
Basic VHH design
modal run modal_mber.py \
--target-pdb 7STF.pdb \
--target-name PDL1
wget https://files.rcsb.org/download/7STF.pdb
modal run modal_mber.py --target-pdb 7STF.pdb --target-name PDL1
Custom masked VHH sequence (* = positions to design)
modal run modal_mber.py \
--target-pdb target.pdb \
--target-name MyTarget \
--masked-binder-seq "EVQLVESGGGLVQPGGSLRLSCAASG*********WFRQAPGKEREF***********NADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYC************WGQGTLVTVSS"
The * characters specify which positions to design (typically CDR1, CDR2, CDR3).
Framework regions remain fixed.
With specific chains and hotspots
modal run modal_mber.py \
--target-pdb target.pdb \
--target-name MyTarget \
--chains A,B \
--target-hotspot-residues A110,B120
Multi-chain with non-contiguous numbering
modal run modal_mber.py \
--target-pdb target.pdb \
--target-name MyTarget \
--chains A,B \
--chain-offsets B:200 \
--target-hotspot-residues A6
Key parameters
| Parameter | Default | Description |
|---|
--target-pdb | required | Target PDB file |
--target-name | required | Name for output files |
--masked-binder-seq | default CDRs | VHH sequence with * for design positions |
--chains | A | Target chains to include |
--target-hotspot-residues | None | Residues to target (e.g., A110,B120) |
--chain-offsets | None | Offset for multi-chain numbering (e.g., B:200) |
--output-dir | ./out/mber | Output directory |
Default design regions
By default, mBER designs the three CDR loops of the VHH:
- CDR1: positions ~26-35
- CDR2: positions ~50-58
- CDR3: positions ~97-110
The framework (FR1, FR2, FR3, FR4) is kept fixed.
Output format
out/mber/
├── design_0.pdb # VHH-target complex
├── design_0.fasta # Designed VHH sequence
└── scores.json # AF-Multimer confidence scores
mBER vs IgGM
| Aspect | mBER | IgGM |
|---|
| Input | Masked VHH sequence | X-masked FASTA |
| Method | AF-Multimer conditioning | Generative model |
| Antibody support | No (VHH only) | Yes (H+L) |
| Best for | VHH scaffold refinement | De novo CDR design |
Troubleshooting
| Error | Cause | Fix |
|---|
CUDA out of memory | Large target | Use A100-80GB |
Chain not found | Wrong chain ID | Check PDB chain IDs |
Invalid masked sequence | Wrong length | Match VHH framework length |
Next: Validate with chai or protenix → protein-qc for filtering.