Skip to main content

gget

CLI/Python toolkit for rapid bioinformatics queries. Preferred for quick BLAST searches. Access to 20+ databases: gene info (Ensembl/UniProt), AlphaFold, ARCHS4, Enrichr, OpenTargets, COSMIC, genome downloads. For advanced BLAST/batch processing, use biopython. For multi-database integration, use bioservices.

Aller à l'installation

Informations de source

Dépôt
tomevault-io/claude-code-plugins
Dernière activité de la source
6 avril 2026 à 08:28
Langue détectée de SKILL.md
anglais
Étoiles
3
Forks
2

Options d'installation

Le prompt qui vérifie d'abord la source est sélectionné par défaut. Vous pouvez passer à une commande directe ou télécharger une copie locale.

Vérifiez les fichiers source

Lisez SKILL.md et les fichiers associés affichés par SkillsMP avant de décider de l'installer.

Affichage de SKILL.md

SKILL.md
Instructions source · Aperçu en lecture seule
name
gget
description
CLI/Python toolkit for rapid bioinformatics queries. Preferred for quick BLAST searches. Access to 20+ databases: gene info (Ensembl/UniProt), AlphaFold, ARCHS4, Enrichr, OpenTargets, COSMIC, genome downloads. For advanced BLAST/batch processing, use biopython. For multi-database integration, use bioservices.
# gget ## Overview gget is a command-line bioinformatics tool and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequence analysis, protein structures, expression data, and disease associations through a consistent interface. All gget modules work both as command-line tools and as Python functions. **Important**: The databases queried by gget are continuously updated, which sometimes changes their structure. gget modules are tested automatically on a biweekly basis and updated to match new database structures when necessary. ## Installation Install gget in a clean virtual environment to avoid conflicts: ```bash # Using uv (recommended) uv uv pip install gget # Or using pip uv pip install --upgrade gget # In Python/Jupyter import gget ``` ## Quick Start Basic usage pattern for all modules: ```bash # Command-line gget <module> [arguments] [options] # Python gget.module(arguments, options) ``` Most modules return: - **Command-line**: JSON (default) or CSV with `-csv` flag - **Python**: DataFrame or dictionary Common flags across modules: - `-o/--out`: Save results to file - `-q/--quiet`: Suppress progress information - `-csv`: Return CSV format (command-line only) ## Module Categories ### 1. Reference & Gene Information #### gget ref - Reference Genome Downloads Retrieve download links and metadata for Ensembl reference genomes. **Parameters**: - `species`: Genus_species format (e.g., 'homo_sapiens', 'mus_musculus'). Shortcuts: 'human', 'mouse' - `-w/--which`: Specify return types (gtf, cdna, dna, cds, cdrna, pep). Default: all - `-r/--release`: Ensembl release number (default: latest) - `-l/--list_species`: List available vertebrate species - `-liv/--list_iv_species`: List available invertebrate species - `-ftp`: Return only FTP links - `-d/--download`: Download files (requires curl) **Examples**: ```bash # List available species gget ref --list_species # Get all reference files for human gget ref homo_sapiens # Download only GTF annotation for mouse gget ref -w gtf -d mouse ``` ```python # Python gget.ref("homo_sapiens") gget.ref("mus_musculus", which="gtf", download=True) ``` #### gget search - Gene Search Locate genes by name or description across species. **Parameters**: - `searchwords`: One or more search terms (case-insensitive) - `-s/--species`: Target species (e.g., 'homo_sapiens', 'mouse') - `-r/--release`: Ensembl release number - `-t/--id_type`: Return 'gene' (default) or 'transcript' - `-ao/--andor`: 'or' (default) finds ANY searchword; 'and' requires ALL - `-l/--limit`: Maximum results to return **Returns**: ensembl_id, gene_name, ensembl_description, ext_ref_description, biotype, URL **Examples**: ```bash # Search for GABA-related genes in human gget search -s human gaba gamma-aminobutyric # Find specific gene, require all terms gget search -s mouse -ao and pax7 transcription ``` ```python # Python gget.search(["gaba", "gamma-aminobutyric"], species="homo_sapiens") ``` #### gget info - Gene/Transcript Information Retrieve comprehensive gene and transcript metadata from Ensembl, UniProt, and NCBI. **Parameters**: - `ens_ids`: One or more Ensembl IDs (also supports WormBase, Flybase IDs). Limit: ~1000 IDs - `-n/--ncbi`: Disable NCBI data retrieval - `-u/--uniprot`: Disable UniProt data retrieval - `-pdb`: Include PDB identifiers (increases runtime) **Returns**: UniProt ID, NCBI gene ID, primary gene name, synonyms, protein names, descriptions, biotype, canonical transcript **Examples**: ```bash # Get info for multiple genes gget info ENSG00000034713 ENSG00000104853 ENSG00000170296 # Include PDB IDs gget info ENSG00000034713 -pdb ``` ```python # Python gget.info(["ENSG00000034713", "ENSG00000104853"], pdb=True) ``` #### gget seq - Sequence Retrieval Fetch nucleotide or amino acid sequences for genes and transcripts. **Parameters**: - `ens_ids`: One or more Ensembl identifiers - `-t/--translate`: Fetch amino acid sequences instead of nucleotide - `-iso/--isoforms`: Return all transcript variants (gene IDs only) **Returns**: FASTA format sequences **Examples**: ```bash # Get nucleotide sequences gget seq ENSG00000034713 ENSG00000104853 # Get all protein isoforms gget seq -t -iso ENSG00000034713 ``` ```python # Python gget.seq(["ENSG00000034713"], translate=True, isoforms=True) ``` ### 2. Sequence Analysis & Alignment #### gget blast - BLAST Searches BLAST nucleotide or amino acid sequences against standard databases. **Parameters**: - `sequence`: Sequence string or path to FASTA/.txt file - `-p/--program`: blastn, blastp, blastx, tblastn, tblastx (auto-detected) - `-db/--database`: - Nucleotide: nt, refseq_rna, pdbnt - Protein: nr, swissprot, pdbaa, refseq_protein - `-l/--limit`: Max hits (default: 50) - `-e/--expect`: E-value cutoff (default: 10.0) - `-lcf/--low_comp_filt`: Enable low complexity filtering - `-mbo/--megablast_off`: Disable MegaBLAST (blastn only) **Examples**: ```bash # BLAST protein sequence gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR # BLAST from file with specific database gget blast sequence.fasta -db swissprot -l 10 ``` ```python # Python gget.blast("MKWMFK...", database="swissprot", limit=10) ``` #### gget blat - BLAT Searches Locate genomic positions of sequences using UCSC BLAT. **Parameters**: - `sequence`: Sequence string or path to FASTA/.txt file - `-st/--seqtype`: 'DNA', 'protein', 'translated%20RNA', 'translated%20DNA' (auto-detected) - `-a/--assembly`: Target assembly (default: 'human'/hg38; options: 'mouse'/mm39, 'zebrafinch'/taeGut2, etc.) **Returns**: genome, query size, alignment positions, matches, mismatches, alignment percentage **Examples**: ```bash # Find genomic location in human gget blat ATCGATCGATCGATCG # Search in different assembly gget blat -a mm39 ATCGATCGATCGATCG ``` ```python # Python gget.blat("ATCGATCGATCGATCG", assembly="mouse") ``` #### gget muscle - Multiple Sequence Alignment Align multiple nucleotide or amino acid sequences using Muscle5. **Parameters**: - `fasta`: Sequences or path to FASTA/.txt file - `-s5/--super5`: Use Super5 algorithm for faster processing (large datasets) **Returns**: Aligned sequences in ClustalW format or aligned FASTA (.afa) **Examples**: ```bash # Align sequences from file gget muscle sequences.fasta -o aligned.afa # Use Super5 for large dataset gget muscle large_dataset.fasta -s5 ``` ```python # Python gget.muscle("sequences.fasta", save=True) ``` #### gget diamond - Local Sequence Alignment Perform fast local protein or translated DNA alignment using DIAMOND. **Parameters**: - Query: Sequences (string/list) or FASTA file path - `--reference`: Reference sequences (string/list) or FASTA file path (required) - `--sensitivity`: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive (default), ultra-sensitive - `--threads`: CPU threads (default: 1) - `--diamond_db`: Save database for reuse - `--translated`: Enable nucleotide-to-amino acid alignment **Returns**: Identity percentage, sequence lengths, match positions, gap openings, E-values, bit scores **Examples**: ```bash # Align against reference gget diamond GGETISAWESQME -ref reference.fasta --threads 4 # Save database for reuse gget diamond query.fasta -ref ref.fasta --diamond_db my_db.dmnd ``` ```python # Python gget.diamond("GGETISAWESQME", reference="reference.fasta", threads=4) ``` ### 3. Structural & Protein Analysis #### gget pdb - Protein Structures Query RCSB Protein Data Bank for structure and metadata. **Parameters**: - `pdb_id`: PDB identifier (e.g., '7S7U') - `-r/--resource`: Data type (pdb, entry, pubmed, assembly, entity types) - `-i/--identifier`: Assembly, entity, or chain ID **Returns**: PDB format (structures) or JSON (metadata) **Examples**: ```bash # Download PDB structure gget pdb 7S7U -o 7S7U.pdb # Get metadata gget pdb 7S7U -r entry ``` ```python # Python gget.pdb("7S7U", save=True) ``` #### gget alphafold - Protein Structure Prediction Predict 3D protein structures using simplified AlphaFold2. **Setup Required**: ```bash # Install OpenMM first uv pip install openmm # Then setup AlphaFold gget setup alphafold ``` **Parameters**: - `sequence`: Amino acid sequence (string), multiple sequences (list), or FASTA file. Multiple sequences trigger multimer modeling - `-mr/--multimer_recycles`: Recycling iterations (default: 3; recommend 20 for accuracy) - `-mfm/--multimer_for_monomer`: Apply multimer model to single proteins - `-r/--relax`: AMBER relaxation for top-ranked model - `plot`: Python-only; generate interactive 3D visualization (default: True) - `show_sidechains`: Python-only; include side chains (default: True) **Returns**: PDB structure file, JSON alignment error data, optional 3D visualization **Examples**: ```bash # Predict single protein structure gget alphafold MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR # Predict multimer with higher accuracy gget alphafold sequence1.fasta -mr 20 -r ``` ```python # Python with visualization gget.alphafold("MKWMFK...", plot=True, show_sidechains=True) # Multimer prediction gget.alphafold(["sequence1", "sequence2"], multimer_recycles=20) ``` #### gget elm - Eukaryotic Linear Motifs Predict Eukaryotic Linear Motifs in protein sequences. **Setup Required**: ```bash gget setup elm ``` **Parameters**: - `sequence`: Amino acid sequence or UniProt Acc - `-u/--uniprot`: Indicates sequence is UniProt Acc - `-e/--expand`: Include protein names, organisms, references - `-s/--sensitivity`: DIAMOND alignment sensitivity (default: "very-sensitive") - `-t/--threads`: Number of threads (default: 1) **Returns**: Two outputs: 1. **ortholog_df**: Linear motifs from orthologous proteins 2. **regex_df**: Motifs directly matched in input sequence **Examples**: ```bash # Predict motifs from sequence gget elm LIAQSIGQASFV -o results # Use UniProt accession with expanded info gget elm --uniprot Q02410 -e ``` ```python # Python ortholog_df, regex_df = gget.elm("LIAQSIGQASFV") ``` ### 4. Expression & Disease Data #### gget archs4 - Gene Correlation & Tissue Expression Query ARCHS4 database for correlated genes or tissue expression data. **Parameters**: - `gene`: Gene symbol or Ensembl ID (with `--ensembl` flag) - `-w/--which`: 'correlation' (default, returns 100 most correlated genes) or 'tissue' (expression atlas) - `-s/--species`: 'human' (default) or 'mouse' (tissue data only) - `-e/--ensembl`: Input is Ensembl ID **Returns**: - **Correlation mode**: Gene symbols, Pearson correlation coefficients - **Tissue mode**: Tissue identifiers, min/Q1/median/Q3/max expression values **Examples**: ```bash # Get correlated genes gget archs4 ACE2 # Get tissue expression gget archs4 -w tissue ACE2 ``` ```python # Python gget.archs4("ACE2", which="tissue") ``` #### gget cellxgene - Single-Cell RNA-seq Data Query CZ CELLxGENE Discover Census for single-cell data. **Setup Required**: ```bash gget setup cellxgene ``` **Parameters**: - `--gene` (-g): Gene names or Ensembl IDs (case-sensitive! 'PAX7' for human, 'Pax7' for mouse) - `--tissue`: Tissue type(s) - `--cell_type`: Specific cell type(s) - `--species` (-s): 'homo_sapiens' (default) or 'mus_musculus' - `--census_version` (-cv): Version ("stable", "latest", or dated) - `--ensembl` (-e): Use Ensembl IDs - `--meta_only` (-mo): Return metadata only
Voir sur GitHub
Ce SKILL.md est tres volumineux, SkillsMP affiche donc ici seulement la premiere section. Voir sur GitHub