| name | boltz2-nim |
| description | Use Boltz2 NIM for biomolecular structure prediction and binding affinity. Invoke for Boltz2, protein structures, protein-ligand/DNA/RNA complexes, SMILES or CCD ligands, pIC50/IC50 affinity scoring, mmCIF output, hosted NVIDIA API calls, or local Docker deployment.
|
| license | Apache-2.0 AND CC-BY-4.0 |
| compatibility | requests>=2.28 |
| allowed-tools | Bash, Read, Write, AskUserQuestion |
Boltz2 NIM
Predict biomolecular structures and optional ligand affinity. Use this
SKILL.md for first-pass hosted/local usage; load supplemental files only when
needed:
references/api.md: exact endpoints, schemas, Docker flags, response fields.
references/science.md: purpose, strengths, limitations, and handoffs.
references/parameters.md: prediction, sampling, MSA, template, affinity tuning.
references/validation.md: mmCIF, confidence, affinity, and chemistry checks.
references/examples.md: compact hosted/local payload patterns.
Choose Mode
Ask only when context is unclear:
Hosted NVIDIA API or local Docker NIM?
- Hosted:
https://health.api.nvidia.com/v1/biology/mit/boltz2/predict
- Local:
http://localhost:8000/biology/mit/boltz2/predict
Hosted requests use Authorization: Bearer $NGC_API_KEY. Supported local Docker
startup uses NGC_API_KEY (or NVIDIA_API_KEY via the preflight) for
registry login, entitlement checks, and first-run model downloads; pass it
into the container with -e NGC_API_KEY. Local inference requests use no
auth header after readiness. Warm-cache key-free startup varies by
image/version and should not be assumed.
Local Docker
For local setup answers, copy the preflight below before docker login,
docker run, readiness, and the no-auth local request. Do not invent a cache
default or drop the .env load or NVIDIA_API_KEY fallback.
set -a
[ -f .env ] && . ./.env
set +a
if [ -z "${NGC_API_KEY:-}" ] && [ -n "${NVIDIA_API_KEY:-}" ]; then
export NGC_API_KEY="$NVIDIA_API_KEY"
fi
: "${NGC_API_KEY:?Set NGC_API_KEY or NVIDIA_API_KEY}"
: "${LOCAL_NIM_CACHE:?Set LOCAL_NIM_CACHE}"
echo "$NGC_API_KEY" | docker login nvcr.io --username '$oauthtoken' --password-stdin
mkdir -p "${LOCAL_NIM_CACHE}"
chmod 755 "${LOCAL_NIM_CACHE}"
docker run --rm --name boltz2 --gpus all \
--shm-size=16G \
-e NGC_API_KEY \
-v "${LOCAL_NIM_CACHE}:/opt/nim/.cache" \
-p 8000:8000 \
nvcr.io/nim/mit/boltz2:1.6.0
Readiness:
until curl -sf http://localhost:8000/v1/health/ready; do sleep 5; done
First startup downloads about 30 GB of model weights.
Request Pattern
import os
import requests
HOSTED = True
url = (
"https://health.api.nvidia.com/v1/biology/mit/boltz2/predict"
if HOSTED else "http://localhost:8000/biology/mit/boltz2/predict"
)
headers = {"Content-Type": "application/json"}
if HOSTED:
headers["Authorization"] = f"Bearer {os.getenv('NGC_API_KEY')}"
payload = {
"polymers": [{
"id": "A",
"molecule_type": "protein",
"sequence": "MTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPT",
}],
"recycling_steps": 3,
"sampling_steps": 50,
"diffusion_samples": 1,
"step_scale": 1.638,
"output_format": "mmcif",
}
response = requests.post(url, headers=headers, json=payload, timeout=300)
response.raise_for_status()
result = response.json()
Payload essentials:
- Protein polymer:
{"molecule_type": "protein", "sequence": "..."}.
- DNA/RNA polymer: add another polymer with
molecule_type "dna" or "rna".
- Ligand by SMILES:
{"id": "L1", "smiles": "CC(=O)OC1=CC=CC=C1C(=O)O"}.
- Ligand by CCD:
{"id": "L1", "ccd": "ATP"}.
- Affinity: set
"predict_affinity": True on exactly one ligand; report
affinity_pic50, affinity_pred_value, and affinity_probability_binary.
- Precomputed A3M MSA goes under the protein polymer. The A3M record uses
alignment, format, and rank; do not use a stale data field.
protein_with_msa = {
"id": "A",
"molecule_type": "protein",
"sequence": "MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPT",
"msa": {"msa_search": {"a3m": {
"alignment": ">query\nMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPT",
"format": "a3m",
"rank": 0,
}}},
}
Save And Report Output
Save every .cif artifact and read the confidence/affinity fields using the
snippet in references/examples.md under Save
Structures And Affinity. Visualize in PyMOL, ChimeraX, or UCSF Chimera. For
confidence/affinity sanity checks, read references/validation.md.
Limits And Troubleshooting
- Polymers/request: 12. Ligands/request: 20. Chain length: 4096 residues.
- Affinity prediction supports one ligand per request and adds runtime.
422: invalid sequence, invalid CCD/SMILES, malformed MSA, or multiple
affinity ligands.
- Local URL/auth: local path has no hosted auth header; wait on
/v1/health/ready.
- Local startup: use
--gpus all, --shm-size=16G, and the /opt/nim/.cache mount.